RetrogeneDB ID: | retro_rnor_1818 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 3:118207284..118207602(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Gabarap | ||
Ensembl ID: | ENSRNOG00000017417 | ||
Aliases: | None | ||
Description: | Gamma-aminobutyric acid receptor-associated protein [Source:UniProtKB/Swiss-Prot;Acc:P60517] |
Percent Identity: | 92.45 % |
Parental protein coverage: | 89.74 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
MKF.YKEEHPFEKRRSEGEKI.KKYPDRVPVIVEKAPKARIGDLDKKKYL.PSDLTVGQFYFLIRKRIHL | |
Retrocopy | MKFMYKEEHPFEKRRSEGEKI*KKYPDRVPVIVEKAPKARIGDLDKKKYLLPSDLTVGQFYFLIRKRIHL |
Parental | RAEDALFFFVNNVIPPTSATMGQLYQE-HHEEDFFL |
.AEDALFFFVNN.I.P.SATMGQLYQE.HHEEDFFL | |
Retrocopy | CAEDALFFFVNNAISPISATMGQLYQEQHHEEDFFL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .07 RPM | 74 .84 RPM |
SRP017611_kidney | 0 .00 RPM | 190 .92 RPM |
SRP017611_liver | 0 .00 RPM | 96 .69 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ciona intestinalis | ENSCING00000012473 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016655 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000013770 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
Mus musculus | ENSMUSG00000018567 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000008049 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006997 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000007901 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000034115 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000017417 | 2 retrocopies |
retro_rnor_1818 , retro_rnor_2093,
|
Rattus norvegicus | ENSRNOG00000017905 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000017936 | 1 retrocopy | |
Drosophila melanogaster | FBgn0052672 | 1 retrocopy |