RetrogeneDB ID: | retro_rnor_1819 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 3:118668109..118668310(+) | ||
Located in intron of: | ENSRNOG00000008316 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Sepw1 | ||
Ensembl ID: | ENSRNOG00000013548 | ||
Aliases: | None | ||
Description: | selenoprotein W [Source:RefSeq peptide;Acc:NP_037159] |
Percent Identity: | 55.71 % |
Parental protein coverage: | 75.27 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAIKAALAQC |
..L..K.KLE.E.P.CLD.CGE.......FF...V.GKLVHSKKRG.......S.F.KLVTA.KA.LAQC | |
Retrocopy | RLLCVKGKLEDELPMCLDMCGE---RPSRFFQMAVDGKLVHSKKRGGSNLGI*SRFQKLVTATKATLAQC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 100 .37 RPM |
SRP017611_kidney | 0 .00 RPM | 3 .14 RPM |
SRP017611_liver | 0 .07 RPM | 3 .23 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015208 | 1 retrocopy | |
Bos taurus | ENSBTAG00000008203 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000004074 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000013206 | 2 retrocopies | |
Felis catus | ENSFCAG00000015176 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000004433 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000013548 | 2 retrocopies |
retro_rnor_1819 , retro_rnor_688,
|
Ictidomys tridecemlineatus | ENSSTOG00000001294 | 1 retrocopy |