RetrogeneDB ID: | retro_sara_72 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
Coordinates: | GeneScaffold_2004:114403..114651(+) | ||
Located in intron of: | ENSSARG00000003526 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PTS | ||
Ensembl ID: | ENSSARG00000001975 | ||
Aliases: | None | ||
Description: | 6-pyruvoyltetrahydropterin synthase [Source:HGNC Symbol;Acc:9689] |
Percent Identity: | 85.71 % |
Parental protein coverage: | 57.24 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | IDPVTGMVINLTSLKEYMEEAIMKPLDHKNLDLDVPYFANIVSTTENVAVYIWESLQKFLPVGVLYKVKV |
....TGMVINLTSLKEYMEEAIMKPLDHKNLDLDV..FA.IVSTTENVAVYIWESLQKFLPVGVLYKVK. | |
Retrocopy | LNTITGMVINLTSLKEYMEEAIMKPLDHKNLDLDVLHFASIVSTTENVAVYIWESLQKFLPVGVLYKVKA |
Parental | -YETDNNVVVYKGE |
.Y.TDNN.VVYKG. | |
Retrocopy | <YDTDNNIVVYKGK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003968 | 3 retrocopies | |
Bos taurus | ENSBTAG00000003770 | 3 retrocopies | |
Canis familiaris | ENSCAFG00000013915 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000014823 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000008145 | 2 retrocopies | |
Felis catus | ENSFCAG00000024702 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000023388 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015255 | 1 retrocopy | |
Sorex araneus | ENSSARG00000001975 | 2 retrocopies |
retro_sara_163, retro_sara_72 ,
|
Sus scrofa | ENSSSCG00000015040 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000010526 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000000061 | 1 retrocopy |