RetrogeneDB ID: | retro_shar_735 | ||
Retrocopylocation | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
Coordinates: | GL861653.1:1297204..1297425(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CRABP2 | ||
Ensembl ID: | ENSSHAG00000015843 | ||
Aliases: | None | ||
Description: | cellular retinoic acid binding protein 2 [Source:HGNC Symbol;Acc:2339] |
Percent Identity: | 81.33 % |
Parental protein coverage: | 53.62 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | NFKIGEEFEEQTVDGRPCKSLVKWESQNKMVCEQRLLKGEGPKTSWSRELTNDGELILT-MTADDVVCTR |
.FKIGEEFEEQ..DGRP.KSLVKWESQNKMVCEQR.LKGE.PKTSWS.EL..D.ELIL...TADDVVCTR | |
Retrocopy | DFKIGEEFEEQRLDGRPHKSLVKWESQNKMVCEQRFLKGEAPKTSWSQELASDEELILS<LTADDVVCTR |
Parental | VYIRE |
VY.RE | |
Retrocopy | VYVRE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Macaca mulatta | ENSMMUG00000002295 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000003313 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000015843 | 1 retrocopy |
retro_shar_735 ,
|
Vicugna pacos | ENSVPAG00000005002 | 1 retrocopy |