RetrogeneDB ID: | retro_sscr_499 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 15:81632065..81632325(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000000408 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 60.44 % |
| Parental protein coverage: | 52.66 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SVPIDLQKVDQFDPFTVPTISSICHELDAISTNEEEK-ENGAESGIKHRTRDYKKTSLAPFVKVFEQFLE |
| S..I..QKV..FDPFT...I.SICHELD.I.T..E.K.E...ESGIKHR.....KTSLA..VKV.EQFLE | |
| Retrocopy | SCAIYFQKVNHFDPFTILAINSICHELDTIPTSDERKEEKEVESGIKHR---IYKTSLAIYVKVSEQFLE |
| Parental | NLDRSR-KGELLKKSDLQKDF |
| .L..S..KGE...KSDLQK.F | |
| Retrocopy | SLSTSQ<KGEVIRKSDLQKRF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 0 .00 RPM |
| SRP014902_testis | 0 .00 RPM | 0 .14 RPM |
| SRP018288_heart | 0 .00 RPM | 0 .65 RPM |
| SRP018288_kidney | 0 .00 RPM | 0 .79 RPM |
| SRP018288_liver | 0 .00 RPM | 1 .12 RPM |
| SRP018288_lung | 0 .00 RPM | 1 .22 RPM |
| SRP018856_adipose | 0 .00 RPM | 0 .00 RPM |
| SRP035408_brain | 0 .00 RPM | 1 .68 RPM |
| SRP035408_liver | 0 .00 RPM | 1 .32 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000015297 | 1 retrocopy | |
| Homo sapiens | ENSG00000198056 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000001603 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017443 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000003458 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000007103 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004672 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022987 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000008017 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000000408 | 1 retrocopy |
retro_sscr_499 ,
|
| Tupaia belangeri | ENSTBEG00000012998 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002153 | 1 retrocopy |