RetrogeneDB ID: | retro_sscr_777 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 4:50267305..50267519(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSSSCG00000023015 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 61.64 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | TSCPRHLALVSEGP-GVYQCSQATRVRVRRGPAVSTSSPGHLVPGPRAPRGRPALPWDSGPGLRACGVDQ |
T.CP..LAL.SEGP.GV.Q.S.ATR..VR.GPA..TS.P.........PR.RPA.P.DSGPG.RA.GVDQ | |
Retrocopy | TICPCRLALESEGP>GVHQLSRATRALVR-GPAGLTSPPRRVALWTDSPRVRPAVPGDSGPGPRA*GVDQ |
Parental | LSR |
LSR | |
Retrocopy | LSR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 0 .00 RPM |
SRP014902_testis | 0 .00 RPM | 0 .00 RPM |
SRP018288_heart | 0 .00 RPM | 0 .00 RPM |
SRP018288_kidney | 0 .00 RPM | 0 .00 RPM |
SRP018288_liver | 0 .00 RPM | 0 .00 RPM |
SRP018288_lung | 0 .00 RPM | 0 .00 RPM |
SRP018856_adipose | 0 .00 RPM | 0 .00 RPM |
SRP035408_brain | 0 .00 RPM | 0 .00 RPM |
SRP035408_liver | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Sus scrofa | ENSSSCG00000023015 | 6 retrocopies | |
Sus scrofa | ENSSSCG00000023484 | 7 retrocopies | |
Sus scrofa | ENSSSCG00000024741 | 1 retrocopy |