RetrogeneDB ID: | retro_tbel_3243 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
Coordinates: | scaffold_134736:102454..102678(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PPP1R1A | ||
Ensembl ID: | ENSTBEG00000001193 | ||
Aliases: | None | ||
Description: | protein phosphatase 1, regulatory (inhibitor) subunit 1A [Source:HGNC Symbol;Acc:9286] |
Percent Identity: | 69.74 % |
Parental protein coverage: | 54.89 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | IRRRRPTPATLV-LTSDQSS-PEIDEDRIPNPLLKSTLSMSPRQRKKMTRTTPTMKELQMMVEHHLGQQQ |
I.R....PATL..LTS..S...EIDED.IPNPLLKSTL.MSP.Q.KKM.R.T.TM.ELQMMVEH.L.QQQ | |
Retrocopy | ICRGTSIPATLG<LTSE*SAIAEIDED*IPNPLLKSTLPMSPGQQKKMPRITCTMRELQMMVEHQLEQQQ |
Parental | Q-EEPE |
Q.EEPE | |
Retrocopy | QGEEPE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Felis catus | ENSFCAG00000010159 | 1 retrocopy | |
Homo sapiens | ENSG00000135447 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000008380 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004608 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005044 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000001193 | 20 retrocopies |
retro_tbel_1191, retro_tbel_1233, retro_tbel_1251, retro_tbel_1264, retro_tbel_138, retro_tbel_1881, retro_tbel_2036, retro_tbel_2437, retro_tbel_2574, retro_tbel_2720, retro_tbel_3243 , retro_tbel_3316, retro_tbel_3377, retro_tbel_3380, retro_tbel_3414, retro_tbel_3426, retro_tbel_4551, retro_tbel_537, retro_tbel_669, retro_tbel_899,
|