RetrogeneDB ID: | retro_tsyr_1813 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
Coordinates: | scaffold_599573:253..475(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HSPB11 | ||
Ensembl ID: | ENSTSYG00000012499 | ||
Aliases: | None | ||
Description: | heat shock protein family B (small), member 11 [Source:HGNC Symbol;Acc:25019] |
Percent Identity: | 75.68 % |
Parental protein coverage: | 51.75 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | RTLKIEKSTSKEPVDXXXXXXXXLVHTEGQLQNEEMVVRDGSATYLRFIIISAFDHFASVHSISAEGIVI |
.TLK.EKSTSKEPVD........LVHTEGQLQNEE.VV.DGSATYLRFI.ISAFD.F.SVHS..AEG.VI | |
Retrocopy | QTLKTEKSTSKEPVDFEQWIKKDLVHTEGQLQNEEIVVCDGSATYLRFIFISAFDNFVSVHSFYAEGTVI |
Parental | SNLS |
SNLS | |
Retrocopy | SNLS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000000284 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000010241 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000002643 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000012499 | 2 retrocopies |
retro_tsyr_1813 , retro_tsyr_697,
|