RetrogeneDB ID: | retro_ttru_1722 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
Coordinates: | scaffold_88452:1463..1643(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C14orf2 | ||
Ensembl ID: | ENSTTRG00000006404 | ||
Aliases: | None | ||
Description: | chromosome 14 open reading frame 2 [Source:HGNC Symbol;Acc:1188] |
Percent Identity: | 86.67 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MLQSLIKNVWVPMKPYYTQVYQEIWAGMGLMAFIVYKIRSADKRSKALKASSPEPARGHH |
MLQSLIKNVW.PM.PYYTQVYQEIW.GMGLM.FI.YKIRSADKRSKALKAS.P.PA.GHH | |
Retrocopy | MLQSLIKNVWIPMIPYYTQVYQEIWVGMGLMGFIFYKIRSADKRSKALKASGPVPAHGHH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000026886 | 4 retrocopies | |
Homo sapiens | ENSG00000156411 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000002297 | 9 retrocopies | |
Nomascus leucogenys | ENSNLEG00000016248 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000006764 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000011548 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000043144 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000002550 | 5 retrocopies | |
Tupaia belangeri | ENSTBEG00000008996 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000006404 | 5 retrocopies | |
Vicugna pacos | ENSVPAG00000001249 | 7 retrocopies |