RetrogeneDB ID: | retro_vpac_92 | ||
Retrocopylocation | Organism: | Alpaca (Vicugna pacos) | |
Coordinates: | GeneScaffold_1734:61409..61720(+) | ||
Located in intron of: | ENSVPAG00000005680 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TIMM17B | ||
Ensembl ID: | ENSVPAG00000009578 | ||
Aliases: | None | ||
Description: | translocase of inner mitochondrial membrane 17 homolog B (yeast) [Source:HGNC Symbol;Acc:17310] |
Percent Identity: | 53.33 % |
Parental protein coverage: | 60. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | EEYAREPCPW-RIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSV-AVRIR-ALIGXSFAVWG |
EEY.RE.CP..R.V.DCGGAF.MG.I..G.FQAIKGF...PVG....L.GS..A...R.......F.V.G | |
Retrocopy | EEYEREFCPG<RTVEDCGGAFMMGTIDSGDFQAIKGFHHYPVGVNQKLQGSLTAIKTRPPQLEGGFTV*G |
Parental | GLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAA |
GL.S..DC.....RGKE..WNS.T..A.TGA..AA | |
Retrocopy | GLSSMTDCSMAHVRGKEHLWNSVTGAAFTGAMPAA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000012474 | 1 retrocopy | |
Bos taurus | ENSBTAG00000018496 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000008768 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000025897 | 2 retrocopies | |
Felis catus | ENSFCAG00000002569 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000011427 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000004174 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000005971 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000009148 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000004547 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000013675 | 1 retrocopy | |
Mus musculus | ENSMUSG00000031158 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007902 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000027418 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000007643 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000014173 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000010396 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000009578 | 1 retrocopy |
retro_vpac_92 ,
|