Detailed information on CNT0001676 (Glycine max)


BLAST search results

BLAST vs PNRD: nothing found

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE (A. thaliana): nothing found

Potentially orthologous lncRNAs
:
CNT0028376 in O. sativa

Most similar lncRNAs
:
CNT0028376, E-value = 5e-94 (O. sativa)
CNT0008455, E-value = 3e-49 (S. tuberosum)

Expression of CNT0001676

Created with Highcharts 4.1.6Chart context menuExpression (RPKM)0007.98900000000000leaves (SRR924099)leaves (SRR924144)leaves (SRR926169)seed (SRR639168)shoot apical meristem (SRR824155)shoot apical meristem (SRR824156)shoot apical meristem (SRR824157)shoot apical meristem (SRR824158)shoot apical meristem (SRR824159)shoot apical meristem (SRR824160)shoot apical meristem (SRR824161)shoot apical meristem (SRR824162)shoot apical meristem (SRR824163)whole seed (SRR639162)whole seed (SRR639164)00.511.522.533.544.555.566.577.588.5

Peptides detected in this lncRNA

>peptide 1 (34 aa)
GVYKAWERIHRRMADRRLLAIPSSCTRVAAYNLN*

Sequence

>CNT0001676
GTGGTGTGTACAAGGCCTGGGAACGAATTCACCGCCGTATGGCTGACCGGCGATTACTAGCGATTCCGTCTTCATGCACGCGAGTTGCAGCCTACAATCT
GAACTGAGGACGAGTTTTTGGAGTTAGCTCACCCTCGCGGGATCGCGATCCTTTGTCCCGTCCATTGTAGCACGTGTGTTGCCCAGGGCATAAGGGGCAT
GAGGACTTGACGTCATCCTCACCTTCCTCCGGCTTATCACCGGA

lncRNA-RNA interactions

Number of interactions: 1

Potential function Interacting transcript Gene description Transcript biotype lncRNA id Alignment score (LAST) Alignment length Transcript region involved in interaction Genomic orientation of interacting RNAs
GLYMA04G33460.1 Uncharacterized protein protein coding CNT0001676 415 159 CDS Cis