RetrogeneDB ID: | retro_btau_1329 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 4:93662298..93662629(+) | ||
| Located in intron of: | ENSBTAG00000003449 | ||
Retrocopy information | Ensembl ID: | ENSBTAG00000047361 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NME2 | ||
| Ensembl ID: | ENSBTAG00000047186 | ||
| Aliases: | None | ||
| Description: | Nucleoside diphosphate kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q3T0Q4] |
| Percent Identity: | 98.2 % |
| Parental protein coverage: | 96.49 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | ERTFIAIKPDGVQRGL-VGEIIKRFEQKGFRLVAMKFLQASEELLKQHYIDLKDRPFFPGLVKYMNSGPV |
| ERTFIAIKPDGVQRGL.VGEIIKRFEQKGF.LVAMKFLQASEELLKQHYIDLKDRPFFPGLVKYMNSGPV | |
| Retrocopy | ERTFIAIKPDGVQRGL>VGEIIKRFEQKGFLLVAMKFLQASEELLKQHYIDLKDRPFFPGLVKYMNSGPV |
| Parental | VAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGR |
| VAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGR | |
| Retrocopy | VAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 8 .58 RPM | 3 .82 RPM |
| ERP005899_muscle | 30 .93 RPM | 61 .55 RPM |
| SRP017611_brain | 16 .22 RPM | 16 .31 RPM |
| SRP017611_kidney | 31 .41 RPM | 28 .45 RPM |
| SRP017611_liver | 12 .08 RPM | 10 .50 RPM |
| SRP030211_testis | 6 .27 RPM | 7 .78 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008022 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000004651 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000047186 | 1 retrocopy |
retro_btau_1329 ,
|
| Equus caballus | ENSECAG00000021658 | 1 retrocopy | |
| Felis catus | ENSFCAG00000006742 | 5 retrocopies | |
| Homo sapiens | ENSG00000011052 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000007784 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016929 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000001940 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015573 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000020857 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000002671 | 8 retrocopies | |
| Sus scrofa | ENSSSCG00000017591 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013053 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007433 | 1 retrocopy |