RetrogeneDB ID: | retro_cfam_1549 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 34:39909161..39909581(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PDZD11 | ||
| Ensembl ID: | ENSCAFG00000028800 | ||
| Aliases: | None | ||
| Description: | PDZ domain containing 11 [Source:HGNC Symbol;Acc:28034] |
| Percent Identity: | 66.9 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected: | 2 |
| Parental | MDSRIPYDDYPVVFLP-AYENPPAWIPPHERVYHPDYNNELTQFLPRIVTLKKPPGAQLGFNIRGGKASQ |
| MD..IPY.D...VFLP..YENPP..I.P...V..PDY.NELTQFLP.I.TLKKPP.AQL.FNI.GGKASQ | |
| Retrocopy | MDHWIPYVD*LEVFLP>TYENPPP*ISPRDQVNYPDYKNELTQFLP*ILTLKKPPEAQLRFNI*GGKASQ |
| Parental | LGIFISKVIPDSDAHRAG-LQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERT |
| .GI.IS.VIP.SDAH....LQEGD.VLA.N.VDFQDIE.SKA.EILKTA.E..M...F.PY.YH...E.T | |
| Retrocopy | WGIYISNVIPESDAHQEN<LQEGD*VLAMNYVDFQDIEQSKADEILKTACESGMSGCFSPYSYHCPREKT |
| Parental | VH |
| VH | |
| Retrocopy | VH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 24 .40 RPM |
| SRP017611_brain | 0 .00 RPM | 18 .82 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .44 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009203 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000028800 | 1 retrocopy |
retro_cfam_1549 ,
|
| Callithrix jacchus | ENSCJAG00000012432 | 1 retrocopy | |
| Equus caballus | ENSECAG00000010771 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008626 | 3 retrocopies | |
| Homo sapiens | ENSG00000120509 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006626 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012040 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013938 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000004220 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000863 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016423 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020929 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021995 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000005380 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002767 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007864 | 1 retrocopy |