RetrogeneDB ID: | retro_cfam_1878 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 7:43030324..43030693(-) | ||
| Located in intron of: | ENSCAFG00000032170 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2C | ||
| Ensembl ID: | ENSCAFG00000009745 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2C [Source:HGNC Symbol;Acc:15937] |
| Percent Identity: | 59.69 % |
| Parental protein coverage: | 68.72 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | PAAASVAAARK--GAEPSGGAARGPVGKRLQQELMTLM-MSGDKGISAFPESDNLFKWVGTI-HGAAGTV |
| PA.A...A.R....A....GAA..PVGKRL..ELM.L..MSG.KGISAFPESD.LFKWVGTI.H..AG.V | |
| Retrocopy | PAHAAQMASRNCHPAAANKGAAWDPVGKRLHEELMSLT>MSGNKGISAFPESD-LFKWVGTI<HRTAGNV |
| Parental | YEDLRYKLSLEFPSGY-PYNAPTVKFLTP-CYHPNVDTQGNICLDILKDKWSALYDVRT |
| .E.......L..P.G..PY..PTVKF.T..CYHPNVDTQG..CLDIL.D..SA..D.RT | |
| Retrocopy | *E-TEVQALLGAPKGL>PYKSPTVKFFTS<CYHPNVDTQGHTCLDILQDR*SAVGDIRT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .42 RPM | 8 .90 RPM |
| SRP017611_brain | 0 .32 RPM | 0 .08 RPM |
| SRP017611_kidney | 0 .13 RPM | 0 .40 RPM |
| SRP017611_liver | 0 .15 RPM | 0 .07 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016746 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000009745 | 6 retrocopies |
retro_cfam_1031, retro_cfam_1805, retro_cfam_1878 , retro_cfam_2078, retro_cfam_290, retro_cfam_356,
|
| Equus caballus | ENSECAG00000014619 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000010643 | 14 retrocopies | |
| Felis catus | ENSFCAG00000001885 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000003164 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000007177 | 14 retrocopies | |
| Microcebus murinus | ENSMICG00000011218 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021023 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000013661 | 6 retrocopies | |
| Mustela putorius furo | ENSMPUG00000017619 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000012176 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004989 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000013564 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007423 | 1 retrocopy |