RetrogeneDB ID: | retro_cfam_259 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 1:48370028..48370472(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RBM3 | ||
| Ensembl ID: | ENSCAFG00000015485 | ||
| Aliases: | None | ||
| Description: | RNA binding motif (RNP1, RRM) protein 3 [Source:HGNC Symbol;Acc:9900] |
| Percent Identity: | 79.05 % |
| Parental protein coverage: | 90.74 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MSSEEGKLFVGGLNFNTDEQALEDHFRSFGPISEVVVVKDRETQRSRGFGFITFTDPEHASDAMRAMNGE |
| MSSEEGKLFVGGLNF.T.EQALEDHF.SFGPISEVVVVKDRETQRSRGFGFITF..PE.ASD.MRAMNGE | |
| Retrocopy | MSSEEGKLFVGGLNFITNEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFSNPEYASDTMRAMNGE |
| Parental | SLDGRQIRVDHAGKSARGTRGGAFGAHGRGRSYSRGGGDQGYGSGRYDSRPGGYGYGYGYGYGY-GRSRD |
| SLDGRQI.VDH.GKSARGTRGGAFGAHGRGRSYS.GGGDQGYGSGRYDS..G...........Y.GRS.. | |
| Retrocopy | SLDGRQICVDHVGKSARGTRGGAFGAHGRGRSYSIGGGDQGYGSGRYDS*SGXXXXXXXRSRDYGGRSQG |
| Parental | YGGRSQGG |
| ...R..GG | |
| Retrocopy | GYDRYSGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .46 RPM | 26 .71 RPM |
| SRP017611_brain | 0 .40 RPM | 10 .64 RPM |
| SRP017611_kidney | 0 .20 RPM | 24 .30 RPM |
| SRP017611_liver | 0 .07 RPM | 10 .88 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000013718 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000012653 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000025848 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000013345 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000015485 | 2 retrocopies |
retro_cfam_1475, retro_cfam_259 ,
|
| Canis familiaris | ENSCAFG00000018962 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000003553 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010420 | 16 retrocopies | |
| Dipodomys ordii | ENSDORG00000000182 | 1 retrocopy | |
| Homo sapiens | ENSG00000102317 | 1 retrocopy | |
| Gadus morhua | ENSGMOG00000012137 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000007003 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003996 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031167 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000007841 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000020314 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021864 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027493 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000008670 | 4 retrocopies |