RetrogeneDB ID: | retro_cfam_602 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 14:37337981..37338432(+) | ||
| Located in intron of: | ENSCAFG00000002784 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM254 | ||
| Ensembl ID: | ENSCAFG00000015748 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 254 [Source:HGNC Symbol;Acc:25804] |
| Percent Identity: | 58.17 % |
| Parental protein coverage: | 98.66 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | GGAAGMAPAAGGEAHFQRMVPLKSEAGRAASAYFRPARRLPALVT-VLAL--GYMAWVVFWPQSVPYQSL |
| GG.....P..........MV..KSEAGRAAS.YFRPA..L...VT.V..L..GY...........P...L | |
| Retrocopy | GGDRDSSPSQDSVCRSFKMVVMKSEAGRAASTYFRPAKYLLVIVT>VIVLALGYFVGCLLTTEYYPLSEL |
| Parental | -GPLGLFTQYLV-DHHHTLLHSGYWLAWLIHVGES-LYAILLVRSKGITNGRAQLLWFLQTFLFGIASLS |
| .GPLGLFTQ.LV..HHHTLLH.G.WL.WLI..GES.L.A..L...KGITN.R.QLLWFLQ.FLFGI.SLS | |
| Retrocopy | >GPLGLFTQDLVYHHHHTLLHNGCWLVWLINMGES<LVAMVLCK*KGITNTRPQLLWFLQIFLFGIGSLS |
| Parental | ILIAYRPKRQKQT |
| ILIAYRPK.QK.T | |
| Retrocopy | ILIAYRPKCQKHT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 24 .11 RPM |
| SRP017611_brain | 0 .00 RPM | 12 .46 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .92 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .19 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000015748 | 3 retrocopies |
retro_cfam_602 , retro_cfam_635, retro_cfam_637,
|
| Callithrix jacchus | ENSCJAG00000007670 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000024625 | 1 retrocopy | |
| Felis catus | ENSFCAG00000026147 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007585 | 16 retrocopies | |
| Macaca mulatta | ENSMMUG00000003015 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000072676 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013679 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028898 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006920 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000006122 | 1 retrocopy |