RetrogeneDB ID: | retro_mmus_2102 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 2:147402938..147403250(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000083126 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Tmem254a | ||
| Ensembl ID: | ENSMUSG00000072676 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 254a [Source:MGI Symbol;Acc:MGI:1196450] |
| Percent Identity: | 76.92 % |
| Parental protein coverage: | 84.55 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | TATGAGYFQRGSLFWFTVITVSFGYYTWAVFWPQSIPYQSLGPLGPFTKYLVDHYHTFLRNGYWLAWLIH |
| T..G...FQRG.L.WF.VIT.SFGYYTW.VFWPQSIP.QSLG.LGPFTKYLVDHYHTFLRNGYWLAWLIH | |
| Retrocopy | TRWGRCSFQRGTLLWFIVITISFGYYTWVVFWPQSIP*QSLGRLGPFTKYLVDHYHTFLRNGYWLAWLIH |
| Parental | VGESLYALVLCKRKGITDVQAQLLWFLQTFLFGV |
| V.ESLY.L.LCKR.GI...QA.LL.FL.T.LFG. | |
| Retrocopy | VRESLYVLILCKR*GIIYSQARLL*FLLTLLFGI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012986 | 4 retrocopies | |
| Bos taurus | ENSBTAG00000001656 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015748 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007670 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000024625 | 1 retrocopy | |
| Felis catus | ENSFCAG00000026147 | 1 retrocopy | |
| Homo sapiens | ENSG00000133678 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007585 | 16 retrocopies | |
| Macaca mulatta | ENSMMUG00000003015 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000003613 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000072676 | 1 retrocopy |
retro_mmus_2102 ,
|
| Nomascus leucogenys | ENSNLEG00000010657 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013679 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028898 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000002293 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006920 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000006122 | 1 retrocopy |