RetrogeneDB ID: | retro_chof_329 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | GeneScaffold_7422:15725..15949(-) | ||
| Located in intron of: | ENSCHOG00000007264 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GABARAPL1 | ||
| Ensembl ID: | ENSCHOG00000001218 | ||
| Aliases: | None | ||
| Description: | GABA(A) receptor-associated protein like 1 [Source:HGNC Symbol;Acc:4068] |
| Percent Identity: | 52.63 % |
| Parental protein coverage: | 64.1 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | FQYKEDHPFEYRKKEGEKIRKKYPDRVPXXXXXAPKARVPDLDKRKYLVPSDLTVGQFYFLIR-KRIHLR |
| F.YKE.H.......E...I.KKYP..V........K....DL.K.KYLVPSDLTVGQF..LIR.K.IHL. | |
| Retrocopy | FMYKE*HSLKKHRSEAK*I*KKYPQQVIVTVEKVTKIQMGDLGKMKYLVPSDLTVGQFFVLIR<KQIHLQ |
| Parental | PEDALF |
| ..DALF | |
| Retrocopy | A*DALF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000001218 | 1 retrocopy |
retro_chof_329 ,
|
| Choloepus hoffmanni | ENSCHOG00000012090 | 7 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016834 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000007434 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002246 | 1 retrocopy |