RetrogeneDB ID: | retro_chof_146 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | GeneScaffold_3276:114541..114772(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCHOG00000012090 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.92 % |
| Parental protein coverage: | 70.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | RVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIXXXXXXXXXXAFFLLVNG |
| .VEDV.LIREQHPTKI.V..ERYKGEKQLPVLDKTKFLVPDHVNMSEL.KII..........AFFLLVNG | |
| Retrocopy | KVEDV*LIREQHPTKILVLTERYKGEKQLPVLDKTKFLVPDHVNMSELTKIIRWCLQLNANQAFFLLVNG |
| Parental | HSMVSVS |
| HSMVS.S | |
| Retrocopy | HSMVSIS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |