RetrogeneDB ID: | retro_cjac_1057 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 12:93933355..93933573(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TRAPPC1 | ||
Ensembl ID: | ENSCJAG00000014756 | ||
Aliases: | None | ||
Description: | trafficking protein particle complex 1 [Source:HGNC Symbol;Acc:19894] |
Percent Identity: | 72.97 % |
Parental protein coverage: | 50.34 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | TVH-NLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYK |
TVH..LYLFD.N.VCLH.S.WH.KKQA.IPKEE.YKLMY.MLFSIR.FVSK.S.LDMK..FLAF..S..K | |
Retrocopy | TVH<HLYLFDQNEVCLHQSKWHHKKQAEIPKEEDYKLMYSMLFSIRLFVSKISQLDMKNSFLAFHISHEK |
Parental | LHYY |
LHY. | |
Retrocopy | LHYW |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 1 .46 RPM |
SRP051959_heart | 0 .00 RPM | 1 .30 RPM |
SRP051959_kidney | 0 .00 RPM | 1 .86 RPM |
SRP051959_liver | 0 .00 RPM | 1 .34 RPM |
SRP051959_lung | 0 .00 RPM | 2 .18 RPM |
SRP051959_lymph_node | 0 .00 RPM | 3 .40 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 2 .66 RPM |
SRP051959_spleen | 0 .00 RPM | 2 .08 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000047214 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000014756 | 1 retrocopy |
retro_cjac_1057 ,
|
Erinaceus europaeus | ENSEEUG00000004320 | 1 retrocopy | |
Sorex araneus | ENSSARG00000010582 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000010306 | 1 retrocopy |