RetrogeneDB ID: | retro_cjac_1303 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 14:82505009..82505292(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000021126 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 73.2 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | MGLEDERKMLTDSGDPKEEEEEEEELV----DPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEED |
| M.LEDE...LT.S.DPKEEEEEEEE.V....DPLTTVREQ.EQL..CVKA.E.LELCDE.VSS.SHTEED | |
| Retrocopy | MELEDE*RNLTESRDPKEEEEEEEE*VFLPQDPLTTVREQYEQLGECVKAQEWLELCDELVSS*SHTEED |
| Parental | CTEELFDFLH-ARD-HCVAHKLFNNLK |
| ..EELFDFLH..RD.HC..HK.FNNLK | |
| Retrocopy | YMEELFDFLH<SRD<HCMSHKFFNNLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 27 .09 RPM |
| SRP051959_heart | 0 .00 RPM | 47 .85 RPM |
| SRP051959_kidney | 0 .00 RPM | 29 .24 RPM |
| SRP051959_liver | 0 .00 RPM | 25 .99 RPM |
| SRP051959_lung | 0 .00 RPM | 13 .45 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 15 .62 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 47 .13 RPM |
| SRP051959_spleen | 0 .00 RPM | 18 .68 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2085 |
| Pan troglodytes | retro_ptro_1534 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009603 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000021126 | 5 retrocopies | |
| Homo sapiens | ENSG00000173660 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010631 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006850 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000063882 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016523 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007600 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001134 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000016059 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025831 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000000691 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000012550 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006763 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011608 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006572 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006326 | 1 retrocopy |