RetrogeneDB ID: | retro_ptro_1792 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 3:71417121..71417390(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UQCRHL | ||
| Ensembl ID: | ENSPTRG00000000691 | ||
| Aliases: | None | ||
| Description: | Cytochrome b-c1 complex subunit 6 [Source:UniProtKB/TrEMBL;Acc:H2PYY7] |
| Percent Identity: | 69.57 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKAR-ERLELCDKRVSSRSHTEEDCTE |
| MGLEDE.KMLT.S.D..EEEE.EEEL.DPLTT.REQC.QLEKCVKAR.E.LELCD...S..S...E.C.. | |
| Retrocopy | MGLEDE*KMLTRSEDLMEEEEQEEELLDPLTTQREQCKQLEKCVKAR<EWLELCDECISFQSQRRE-CHG |
| Parental | ELFDFLHARDHCVAHKLFNNLK |
| ...DFLHARDH.V.HKLFN.LK | |
| Retrocopy | GALDFLHARDH*VTHKLFNSLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 119 .33 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 133 .54 RPM |
| SRP007412_heart | 0 .00 RPM | 312 .53 RPM |
| SRP007412_kidney | 0 .00 RPM | 151 .50 RPM |
| SRP007412_liver | 0 .00 RPM | 59 .22 RPM |
| SRP007412_testis | 0 .00 RPM | 37 .52 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2659 |
| Gorilla gorilla | retro_ggor_1855 |
| Pongo abelii | retro_pabe_2314 |
| Callithrix jacchus | retro_cjac_1337 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009603 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000021126 | 5 retrocopies | |
| Homo sapiens | ENSG00000173660 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010631 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006850 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000063882 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016523 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007600 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001134 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000016059 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025831 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000000691 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000012550 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006763 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011608 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006572 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006326 | 1 retrocopy |