RetrogeneDB ID: | retro_rnor_1227 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 16:40978658..40978927(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Uqcrh | ||
| Ensembl ID: | ENSRNOG00000012550 | ||
| Aliases: | None | ||
| Description: | Cytochrome b-c1 complex subunit 6, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q5M9I5] |
| Percent Identity: | 78.02 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MGLEDERKMLTGSGDPK-EEEEEELVDPLTTVREHCEQLEKCVKARERLESCD-RRVSSRSQTEEDCTEE |
| .GL.D...MLTG.GDPK.EEEEEELVD.LTTV.EHCEQLEKCVKARE.L..C....VSSRSQTEE.CTEE | |
| Retrocopy | LGLKDKYRMLTGAGDPKKEEEEEELVDLLTTVKEHCEQLEKCVKAREQLVLCE<KHVSSRSQTEENCTEE |
| Parental | LFDFLHARDHCVAHKLFKSLK |
| LFD..HARDHCVAHKL.KSLK | |
| Retrocopy | LFDLVHARDHCVAHKLLKSLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 54 .28 RPM |
| SRP017611_kidney | 0 .00 RPM | 88 .41 RPM |
| SRP017611_liver | 0 .00 RPM | 38 .19 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009603 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000021126 | 5 retrocopies | |
| Homo sapiens | ENSG00000173660 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010631 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006850 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000063882 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016523 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007600 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001134 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000016059 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025831 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000000691 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000012550 | 1 retrocopy |
retro_rnor_1227 ,
|
| Sorex araneus | ENSSARG00000006763 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011608 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006572 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006326 | 1 retrocopy |