RetrogeneDB ID: | retro_cjac_1329 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 15:27200753..27201133(+) | ||
Located in intron of: | ENSCJAG00000005537 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DPPA3 | ||
Ensembl ID: | ENSCJAG00000005409 | ||
Aliases: | None | ||
Description: | developmental pluripotency associated 3 [Source:HGNC Symbol;Acc:19199] |
Percent Identity: | 65.89 % |
Parental protein coverage: | 77.64 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MDPTQKFNLTFIPESSQMVTGETYQDDSGASQNFS-ETLIKNLSKLTLNASTEFPSP-LPEGSLQQS-AG |
M...QKF..T...E..QM.T.E..QDDSGASQNF..E.LIKNLS.LT.N.STEFP.P.LPEGS.QQ...G | |
Retrocopy | MGTSQKFDPTLVTEPLQMLTEENSQDDSGASQNFCFEMLIKNLSNLTINPSTEFPFP>LPEGSPQQQYTG |
Parental | AAILREIGDDLPYRRRGVRTLLSVKRE-RLARLRYMLLGRGPRPERPLMNTGLKGVKNA |
A.IL.EIGDDL.YR..GVRTLLS...E.R.A..RYMLLGR.PR.ER.L.NTGLKGV.N. | |
Retrocopy | AMILGEIGDDLLYRK-GVRTLLSMQKE>RMAKSRYMLLGRVPRLERELTNTGLKGVQNS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .33 RPM | 0 .00 RPM |
SRP051959_heart | 0 .44 RPM | 0 .00 RPM |
SRP051959_kidney | 0 .67 RPM | 0 .00 RPM |
SRP051959_liver | 0 .41 RPM | 0 .00 RPM |
SRP051959_lung | 0 .41 RPM | 0 .00 RPM |
SRP051959_lymph_node | 0 .71 RPM | 0 .00 RPM |
SRP051959_skeletal_muscle | 0 .26 RPM | 0 .02 RPM |
SRP051959_spleen | 0 .59 RPM | 0 .00 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2648 |
Pan troglodytes | retro_ptro_1783 |
Gorilla gorilla | retro_ggor_1849 |
Pongo abelii | retro_pabe_2323 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000046609 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000032092 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005409 | 10 retrocopies |
retro_cjac_1329 , retro_cjac_1446, retro_cjac_1465, retro_cjac_1474, retro_cjac_2052, retro_cjac_2628, retro_cjac_3162, retro_cjac_4006, retro_cjac_622, retro_cjac_730,
|
Homo sapiens | ENSG00000187569 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000013040 | 4 retrocopies | |
Mustela putorius furo | ENSMPUG00000017530 | 3 retrocopies | |
Mus musculus | ENSMUSG00000046323 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026887 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000024813 | 7 retrocopies | |
Pongo abelii | ENSPPYG00000004230 | 6 retrocopies | |
Pan troglodytes | ENSPTRG00000004617 | 7 retrocopies | |
Rattus norvegicus | ENSRNOG00000022950 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000000751 | 3 retrocopies |