RetrogeneDB ID: | retro_cjac_1374 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 15:4627692..4628042(-) | ||
Located in intron of: | ENSCJAG00000005148 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C9orf85 | ||
Ensembl ID: | ENSCJAG00000001441 | ||
Aliases: | None | ||
Description: | chromosome 9 open reading frame 85 [Source:HGNC Symbol;Acc:28784] |
Percent Identity: | 67.23 % |
Parental protein coverage: | 75.16 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | LHDGVCQHCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIICRPCAYELEVCAKCGKKEDIVIPF |
.HDG.CQH.KEVLEWRVKYSKYKPLSKP.KCVKCLQ.T..DSYHI.CRP.AYELE.CAKCGKK....... | |
Retrocopy | IHDGLCQHSKEVLEWRVKYSKYKPLSKP*KCVKCLQQTLEDSYHITCRPRAYELEICAKCGKKTLLFCSV |
Parental | NNKS-EKTEHIENNPSSNHRRSCRRNEESDDDLDFDIDLEDTEGNHQMN |
.N..........N..SS..R.SCRR.EESDDDLDFDIDLED..G..Q.N | |
Retrocopy | KNQA<QSENAENNLSSSHRR-SCRRKEESDDDLDFDIDLEDIGGDCQIN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 1 .11 RPM | 6 .32 RPM |
SRP051959_heart | 0 .49 RPM | 5 .91 RPM |
SRP051959_kidney | 0 .95 RPM | 6 .37 RPM |
SRP051959_liver | 0 .52 RPM | 4 .29 RPM |
SRP051959_lung | 0 .68 RPM | 5 .53 RPM |
SRP051959_lymph_node | 0 .78 RPM | 7 .67 RPM |
SRP051959_skeletal_muscle | 0 .63 RPM | 3 .82 RPM |
SRP051959_spleen | 0 .82 RPM | 7 .12 RPM |
Species | RetrogeneDB ID |
---|---|
Pongo abelii | retro_pabe_2397 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000007254 | 1 retrocopy | |
Bos taurus | ENSBTAG00000006831 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000001820 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000001441 | 2 retrocopies |
retro_cjac_1283, retro_cjac_1374 ,
|
Cavia porcellus | ENSCPOG00000025848 | 2 retrocopies | |
Felis catus | ENSFCAG00000031942 | 1 retrocopy | |
Homo sapiens | ENSG00000155621 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000024309 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000018881 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000008971 | 1 retrocopy | |
Mus musculus | ENSMUSG00000035171 | 6 retrocopies | |
Nomascus leucogenys | ENSNLEG00000001023 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000024578 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000011302 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000029745 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000021018 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000027161 | 5 retrocopies | |
Sorex araneus | ENSSARG00000004523 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015556 | 6 retrocopies |