RetrogeneDB ID: | retro_cjac_2601 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 5:26557645..26557942(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000013012 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 63.64 % |
Parental protein coverage: | 51.3 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VVARTAARTIHTGARQLQDAAAKQEVEEKSAAPRHTSFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASY |
..AR....TIH.G...LQD..AKQ.VEEK...P.HTSFSIYPPI.....SLR.A.KKF.EIPIAHIKAS. | |
Retrocopy | IMARMLVQTIHAGTQKLQDVEAKQKVEEKMVVPCHTSFSIYPPILKGNCSLR*ARKKFWEIPIAHIKASC |
Parental | NNTQIQVLSASNQPLAHASCGTEGFRNAR |
.NT.IQ..SA.NQPLAH.SCGTE.F.N.. | |
Retrocopy | SNTEIQIISATNQPLAHTSCGTEKFPNVK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 4 .24 RPM |
SRP051959_heart | 0 .00 RPM | 5 .79 RPM |
SRP051959_kidney | 0 .00 RPM | 5 .99 RPM |
SRP051959_liver | 0 .00 RPM | 5 .07 RPM |
SRP051959_lung | 0 .00 RPM | 4 .08 RPM |
SRP051959_lymph_node | 0 .00 RPM | 4 .93 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 9 .57 RPM |
SRP051959_spleen | 0 .00 RPM | 5 .15 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000013012 | 2 retrocopies |
retro_cjac_2601 , retro_cjac_2989,
|
Felis catus | ENSFCAG00000014967 | 1 retrocopy | |
Homo sapiens | ENSG00000181991 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000015152 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000013659 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011441 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000008247 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006751 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000007420 | 1 retrocopy |