RetrogeneDB ID: | retro_cjac_2880 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 7:55445319..55445695(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PPP1R11 | ||
Ensembl ID: | ENSCJAG00000020710 | ||
Aliases: | None | ||
Description: | protein phosphatase 1, regulatory (inhibitor) subunit 11 [Source:HGNC Symbol;Acc:9285] |
Percent Identity: | 59.69 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 2 |
Parental | MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMG-RRSSKC-C-CIYEKP |
MA..GAGLS............EPEN.SL.IKLRK.KPEKKV.W.SDTVDNEHMG.R.SS.C.C.C..E.. | |
Retrocopy | MADTGAGLS*XXXXXXXXXXXEPEN*SLSIKLRKQKPEKKVKWISDTVDNEHMG<RHSSECCC<CL*EHK |
Parental | RAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRASLG--PTTPPQPPDPSQPPPGPMQH |
.AFGESS.E...........TH.V.GHRKG...A.LG..PTTPPQPPDPSQPP.GP..H | |
Retrocopy | LAFGESSMERMRRKKRAV-LTHYVHGHRKGLCHATLGPTPTTPPQPPDPSQPPSGPTKH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 17 .46 RPM |
SRP051959_heart | 0 .00 RPM | 10 .58 RPM |
SRP051959_kidney | 0 .00 RPM | 19 .30 RPM |
SRP051959_liver | 0 .00 RPM | 14 .84 RPM |
SRP051959_lung | 0 .00 RPM | 20 .24 RPM |
SRP051959_lymph_node | 0 .00 RPM | 21 .03 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 10 .35 RPM |
SRP051959_spleen | 0 .00 RPM | 18 .30 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000020710 | 1 retrocopy |
retro_cjac_2880 ,
|
Felis catus | ENSFCAG00000013592 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000026830 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000006493 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000012122 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000016021 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000004933 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000001598 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000008330 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003632 | 1 retrocopy |