RetrogeneDB ID: | retro_cjac_3039 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 7:152968444..152968688(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPF | ||
| Ensembl ID: | ENSCJAG00000002705 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide F [Source:HGNC Symbol;Acc:11162] |
| Percent Identity: | 80.95 % |
| Parental protein coverage: | 95.35 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | LNPKPFLNGLTGKPVMVKLKWGMEYK-GYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIR |
| LNPKPFL.GLTG.PV.VKL.WGMEY..GYLVSVDGY.N.QLANTEEYI.GAL.GHL.EVLIR.N...YIR | |
| Retrocopy | LNPKPFLSGLTGTPVVVKLRWGMEYR<GYLVSVDGYRNLQLANTEEYIGGALPGHLWEVLIRRNHIPYIR |
| Parental | GVE-EEEEDGEMRE |
| GVE.EEEEDGEMRE | |
| Retrocopy | GVE<EEEEDGEMRE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 5 .79 RPM |
| SRP051959_heart | 0 .00 RPM | 5 .63 RPM |
| SRP051959_kidney | 0 .02 RPM | 6 .37 RPM |
| SRP051959_liver | 0 .00 RPM | 4 .27 RPM |
| SRP051959_lung | 0 .00 RPM | 5 .86 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 6 .55 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 5 .53 RPM |
| SRP051959_spleen | 0 .00 RPM | 6 .09 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000006395 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002705 | 2 retrocopies |
retro_cjac_1705, retro_cjac_3039 ,
|
| Erinaceus europaeus | ENSEEUG00000013509 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000001558 | 3 retrocopies | |
| Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
| Latimeria chalumnae | ENSLACG00000002456 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000017426 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000008091 | 3 retrocopies | |
| Pelodiscus sinensis | ENSPSIG00000016462 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000012294 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006837 | 4 retrocopies |