RetrogeneDB ID: | retro_cjac_4121 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | X:117763843..117764070(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | POLE3 | ||
Ensembl ID: | ENSCJAG00000017917 | ||
Aliases: | None | ||
Description: | polymerase (DNA directed), epsilon 3, accessory subunit [Source:HGNC Symbol;Acc:13546] |
Percent Identity: | 66.23 % |
Parental protein coverage: | 51.7 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | ERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTL-NATDVLS |
..P.DLNLPNA.ITRI.KEAL.D.V.ISKEARSAIS.AAS..VLY.TSCANN.AMKGK.KTL........ | |
Retrocopy | QKPKDLNLPNASITRINKEALLDNVSISKEARSAISHAASILVLYTTSCANNLAMKGKCKTL<DVLSAME |
Parental | AMEEMEF |
.ME...F | |
Retrocopy | EMEFQQF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 17 .11 RPM |
SRP051959_heart | 0 .00 RPM | 11 .47 RPM |
SRP051959_kidney | 0 .00 RPM | 17 .44 RPM |
SRP051959_liver | 0 .00 RPM | 11 .85 RPM |
SRP051959_lung | 0 .00 RPM | 15 .32 RPM |
SRP051959_lymph_node | 0 .00 RPM | 15 .07 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 12 .47 RPM |
SRP051959_spleen | 0 .00 RPM | 19 .73 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000014610 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000017917 | 1 retrocopy |
retro_cjac_4121 ,
|
Cavia porcellus | ENSCPOG00000000313 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000003073 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000004358 | 3 retrocopies | |
Mus musculus | ENSMUSG00000028394 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000004717 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000015392 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000027365 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005211 | 1 retrocopy |