RetrogeneDB ID: | retro_mdom_1680 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 6:171196698..171197029(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | POLE3 | ||
Ensembl ID: | ENSMODG00000004358 | ||
Aliases: | None | ||
Description: | polymerase (DNA directed), epsilon 3, accessory subunit [Source:HGNC Symbol;Acc:13546] |
Percent Identity: | 52.59 % |
Parental protein coverage: | 77.4 % |
Number of stop codons detected: | 5 |
Number of frameshifts detected | 1 |
Parental | RSAISRAASVFVLYATSCANNFAMKGKRKTLNAGDVLSAMEEMEFQRFISPLKEALDAYRREQKGKKEAS |
.SA.S.A...FVLY..S.ANNFA.KGKRKTLNAGDVLSAMEEMEFQ..ISPL...L........G...A. | |
Retrocopy | KSATSQATRMFVLYPMSWANNFAVKGKRKTLNAGDVLSAMEEMEFQQVISPLI*VL*M*TEN*QGSFRAK |
Parental | EQKKKDKDK--RIDSEEQ-DKSREDDNDEDDERMEEEEQNDEEVDN |
E...K..D...R.......D...EDD........EEE.QNDEE.DN | |
Retrocopy | EDREKQTDGF*RVRQDQE>DDNDEDD----ERMKEEE-QNDEEADN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 107 .16 RPM |
SRP007412_cerebellum | 0 .00 RPM | 49 .29 RPM |
SRP007412_heart | 0 .00 RPM | 18 .34 RPM |
SRP007412_kidney | 0 .00 RPM | 71 .11 RPM |
SRP007412_liver | 0 .00 RPM | 31 .22 RPM |
SRP007412_testis | 0 .00 RPM | 344 .54 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000017917 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000000313 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000003073 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000004358 | 3 retrocopies |
retro_mdom_1680 , retro_mdom_1920, retro_mdom_647,
|
Mus musculus | ENSMUSG00000028394 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000004717 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000015392 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000027365 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005211 | 1 retrocopy |