RetrogeneDB ID: | retro_cjac_4165 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | X:52907015..52907368(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000015775 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 63.03 % |
Parental protein coverage: | 58.13 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYKEYKD |
M..P.P.E.KAG.L.FAKM.GY.HW.A.IDE.PE...K.P..K...FF.....TAFL..KDLFPY..YK. | |
Retrocopy | MEHPQPHEEKAGCLLFAKMTGYSHWLAWIDEFPERTMKSPRKKAFYFFLSAPMTAFLVSKDLFPYEDYKE |
Parental | -KFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTA |
..F.KSNK.KGF.EGLW.IENNPG.KFTG.QAIQQQ.SSETE.EG...A | |
Retrocopy | <EFRKSNK*KGFSEGLWKIENNPGIKFTGCQAIQQQ*SSETEVEGTASA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 5 .06 RPM |
SRP051959_heart | 0 .00 RPM | 20 .70 RPM |
SRP051959_kidney | 0 .00 RPM | 5 .13 RPM |
SRP051959_liver | 0 .04 RPM | 1 .34 RPM |
SRP051959_lung | 0 .00 RPM | 12 .79 RPM |
SRP051959_lymph_node | 0 .00 RPM | 2 .97 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 3 .14 RPM |
SRP051959_spleen | 0 .00 RPM | 6 .74 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000018527 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000006157 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000012471 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000015775 | 1 retrocopy |
retro_cjac_4165 ,
|
Dasypus novemcinctus | ENSDNOG00000003696 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000010466 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000002512 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000028389 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000004950 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000004599 | 1 retrocopy |