RetrogeneDB ID: | retro_cjac_589 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 1:91816119..91816534(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EIF3J | ||
Ensembl ID: | ENSCJAG00000002412 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 53.47 % |
Parental protein coverage: | 54.44 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | PAPAAANGGDSDSWDADAFSVEDPVRKVG-GGGTAGGDRWEGEDEDEDVKDNWDDDDDEK-KEEAEVKPG |
P.P.A..GG..DS..AD..SV...V..VG.GG.TA.GD.WE.E.E...VK.N.DDDDD.K.K.EA.VK.. | |
Retrocopy | PGPVAVVGG-FDSQGADESSVGALVQRVG<GGSTASGDHWEAENEE--VKENRDDDDDKKEKKEAAVKQE |
Parental | FSISEHIYMVQKLKRDERVFKKAIEATPVKLEEPE-EPKVLTPEEQLADKLRLKKLQEESDLELAKETFG |
..ISE...M....K..E...KK........LEE.E.EPKVL.PEEQ......LKKLQEESDL.LAKE.F. | |
Retrocopy | ITISEKKKMAEEIKEKEQQ*KKRPGEMKKRLEETE<EPKVLKPEEQFNR*TTLKKLQEESDLKLAKEIFI |
Parental | VNNT |
.NNT | |
Retrocopy | INNT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 16 .97 RPM |
SRP051959_heart | 0 .02 RPM | 22 .96 RPM |
SRP051959_kidney | 0 .00 RPM | 21 .85 RPM |
SRP051959_liver | 0 .00 RPM | 23 .22 RPM |
SRP051959_lung | 0 .00 RPM | 22 .66 RPM |
SRP051959_lymph_node | 0 .00 RPM | 24 .02 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 37 .52 RPM |
SRP051959_spleen | 0 .00 RPM | 23 .26 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000002412 | 1 retrocopy |
retro_cjac_589 ,
|
Cavia porcellus | ENSCPOG00000012396 | 3 retrocopies | |
Dipodomys ordii | ENSDORG00000008339 | 7 retrocopies | |
Equus caballus | ENSECAG00000008716 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000005052 | 1 retrocopy | |
Homo sapiens | ENSG00000104131 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000000548 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000010372 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000005006 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017696 | 1 retrocopy | |
Mus musculus | ENSMUSG00000027236 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005568 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000005376 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000004694 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006431 | 1 retrocopy |