RetrogeneDB ID: | retro_cjac_597 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 1:102790711..102790905(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | YPEL1 | ||
Ensembl ID: | ENSCJAG00000015755 | ||
Aliases: | None | ||
Description: | yippee-like 1 (Drosophila) [Source:HGNC Symbol;Acc:12845] |
Percent Identity: | 57.58 % |
Parental protein coverage: | 54.62 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNS-VVNVGCGPAEER |
..KMT.S.TF..YLPNCH..Y.C.HC..HLANH..LI.K....SQ....LFNS...NVGCG.AE.R | |
Retrocopy | VIKMTNSITFPGYLPNCH*IYCCLHCKPHLANHALLIFKLSCVSQNKDCLFNS<WENVGCGSAEGR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 1 .77 RPM |
SRP051959_heart | 0 .00 RPM | 3 .82 RPM |
SRP051959_kidney | 0 .02 RPM | 2 .26 RPM |
SRP051959_liver | 0 .00 RPM | 1 .58 RPM |
SRP051959_lung | 0 .00 RPM | 4 .42 RPM |
SRP051959_lymph_node | 0 .00 RPM | 5 .64 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 2 .01 RPM |
SRP051959_spleen | 0 .00 RPM | 3 .40 RPM |
Species | RetrogeneDB ID |
---|---|
Equus caballus | retro_ecab_616 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000001397 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000015755 | 1 retrocopy |
retro_cjac_597 ,
|
Dasypus novemcinctus | ENSDNOG00000024482 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000008187 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000013638 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000016725 | 1 retrocopy |