RetrogeneDB ID: | retro_pvam_162 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
Coordinates: | GeneScaffold_1694:250220..250405(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | YPEL1 | ||
Ensembl ID: | ENSPVAG00000013638 | ||
Aliases: | None | ||
Description: | yippee-like 1 (Drosophila) [Source:HGNC Symbol;Acc:12845] |
Percent Identity: | 57.14 % |
Parental protein coverage: | 52.1 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | KMTKSKTFQAYLPNCHRTYSCVHCRAHLANHDELISKSFQGSQGRAYLFNS-VVNVGCGPAEE |
KMT.SKTFQ.YL.NCH..Y....C.A..ANHD.LISK....S...A..FNS..VNVGC..AE. | |
Retrocopy | KMTDSKTFQGYLTNCHWIYCYTYCKAP*ANHDMLISKPCHVSHHKAHFFNS<WVNVGCASAED |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000001397 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000015755 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000024482 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000008187 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000013638 | 1 retrocopy |
retro_pvam_162 ,
|
Tursiops truncatus | ENSTTRG00000016725 | 1 retrocopy |