RetrogeneDB ID: | retro_cjac_725 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 10:98551008..98551227(+) | ||
Located in intron of: | ENSCJAG00000014352 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000004957 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 78.08 % |
Parental protein coverage: | 64.6 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | VPSLIVGLFFGSLAGLGSYQLSQDPKNVWLFLATSGTFAGVMALRSYYYGKVMPVGLIAGASLLMVAKVG |
VPSL..GL.FGSL.GLGSYQLSQDP.NVW.FLATSGT.AG.M..R.Y..GK.MP.GLIAGASLLMVAKVG | |
Retrocopy | VPSLAAGLLFGSLTGLGSYQLSQDPRNVWVFLATSGTLAGIMGIRFYNSGKFMPAGLIAGASLLMVAKVG |
Parental | VRM |
V.M | |
Retrocopy | VSM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 2 .06 RPM | 2 .06 RPM |
SRP051959_heart | 1 .82 RPM | 2 .65 RPM |
SRP051959_kidney | 4 .17 RPM | 3 .68 RPM |
SRP051959_liver | 3 .12 RPM | 2 .45 RPM |
SRP051959_lung | 1 .89 RPM | 3 .03 RPM |
SRP051959_lymph_node | 1 .69 RPM | 2 .26 RPM |
SRP051959_skeletal_muscle | 3 .14 RPM | 3 .30 RPM |
SRP051959_spleen | 2 .23 RPM | 2 .50 RPM |