RetrogeneDB ID: | retro_cpor_1290 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_65:5660162..5660450(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA2 | ||
| Ensembl ID: | ENSCPOG00000009178 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 [Source:UniProtKB/TrEMBL;Acc:H0VE12] |
| Percent Identity: | 50.52 % |
| Parental protein coverage: | 96.97 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 0 |
| Parental | AAAASRVVGAKLGLREIRIHLCQRSPGSQGVRDFIQKRYV-ELKKANPDLPILIRECSDVQPKLWARYAF |
| .A..S..VGA.LGL.EI.IHL........G.....Q...........P.LPI....CS.VQPKL.A.Y.F | |
| Retrocopy | SATIS*AVGADLGLCEICIHLMPALAWQSGCQGLQQEILCGAAEECEP*LPIPTCKCSHVQPKL*ACYSF |
| Parental | GQEKNVSLNNFSADQVTRALENVLSGK |
| G..KNVSLN.F..DQVTR.LENV.SGK | |
| Retrocopy | G*KKNVSLNSFN-DQVTRTLENVFSGK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 15 .53 RPM |
| SRP017611_kidney | 0 .00 RPM | 34 .86 RPM |
| SRP017611_liver | 0 .00 RPM | 29 .47 RPM |
| SRP040447_lung | 0 .00 RPM | 19 .92 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 49 .45 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015041 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000005861 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016525 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000009178 | 2 retrocopies |
retro_cpor_1045, retro_cpor_1290 ,
|
| Latimeria chalumnae | ENSLACG00000005796 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000014294 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009325 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000027727 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015860 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017571 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000014371 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005978 | 1 retrocopy |