RetrogeneDB ID: | retro_cpor_139 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_0:72991012..72991211(+) | ||
| Located in intron of: | ENSCPOG00000002251 | ||
Retrocopy information | Ensembl ID: | ENSCPOG00000023483 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSCPOG00000000802 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.41 % |
| Parental protein coverage: | 57.26 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MVQRLTYRR-RLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRL |
| MVQ.LTY...RLSYNTA.NKTRLSRTPGNRIVYLYTKK..K.PKS.CG.C.GRL.GV.AVRP.VLMRL | |
| Retrocopy | MVQHLTYHQ>RLSYNTA-NKTRLSRTPGNRIVYLYTKKMRKGPKSVCGMCLGRL*GVHAVRPQVLMRL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 90 .42 RPM |
| SRP017611_kidney | 0 .00 RPM | 142 .90 RPM |
| SRP017611_liver | 0 .00 RPM | 86 .97 RPM |
| SRP040447_lung | 0 .03 RPM | 189 .84 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 148 .17 RPM |