RetrogeneDB ID: | retro_mputfur_1305 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL897075.1:2838977..2839202(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Gm2178 | ||
| Ensembl ID: | ENSMPUG00000008873 | ||
| Aliases: | None | ||
| Description: | predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348] |
| Percent Identity: | 65.33 % |
| Parental protein coverage: | 61.48 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | KAPKSACGVCPGRLRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKA |
| .A.KSACG.CPG.LRGV.AVRPKV.MRLS.TK.H..RA.GG.M..KCV.DRIK.AFL..EQK....V..A | |
| Retrocopy | EAQKSACGWCPGQLRGVCAVRPKVCMRLSQTKIHICRA*GGFM*VKCVPDRIKCAFLTDEQKPIMEV*NA |
| Parental | QAQSQ |
| QA.S. | |
| Retrocopy | QAESE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |