RetrogeneDB ID: | retro_cpor_414 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_148:1004889..1005131(+) | ||
| Located in intron of: | ENSCPOG00000007773 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL35 | ||
| Ensembl ID: | ENSCPOG00000022811 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 62.2 % |
| Parental protein coverage: | 65.04 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | VAKVTGG-AASKLSKIRVVRKSIARVLTVINQTQKENLRKYYKGKKYKPLDLRPKK-TRAMRRRLNKHEE |
| V.KVT....AS.LSKI.VV.KSI....T.I.QTQKENLRK..K.KK.KPLDL.PKK.T.A....L.K..E | |
| Retrocopy | VTKVTSRHMASNLSKI*VVCKSITCIFTFIKQTQKENLRKFSKCKK*KPLDLQPKK<TQALHHKLKKQDE |
| Parental | KLKTKKQQRKER |
| KLKTK.QQ.KE. | |
| Retrocopy | KLKTKRQQWKEQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 57 .11 RPM |
| SRP017611_kidney | 0 .00 RPM | 97 .15 RPM |
| SRP017611_liver | 0 .00 RPM | 45 .31 RPM |
| SRP040447_lung | 0 .05 RPM | 105 .75 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 103 .16 RPM |