RetrogeneDB ID: | retro_dnov_104 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_1605:406607..406950(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000007983 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 59.48 % |
| Parental protein coverage: | 62.16 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLA-GCLTKSSENGALPVVSVMRETESQLLPDVGA |
| M.PP.R.C.PGERLC.LEEGS.G.GTY..H..IFS.LA..CL.K..E..A........E...Q.LP..G. | |
| Retrocopy | MVPPTRDCLPGERLCHLEEGSLGRGTYAWHNDIFSLLA>SCLMKAAET-ACCLQRLGWERQPQVLPALGD |
| Parental | IVTCKVSSINSRFAKVHILYVGSTPLKNSFRGTIRKEDVRATEKDK |
| IV..KVSS.NS.FAKVHIL.VGSTPL.NSF.G.I..E..RATE.DK | |
| Retrocopy | IVARKVSSTNSHFAKVHIL*VGSTPLENSF*GPIHMEGTRATEIDK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 6 .81 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 5 .91 RPM |
| SRP012922_heart | 0 .00 RPM | 3 .25 RPM |
| SRP012922_kidney | 0 .00 RPM | 4 .93 RPM |
| SRP012922_liver | 0 .00 RPM | 3 .10 RPM |
| SRP012922_lung | 0 .00 RPM | 7 .48 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 3 .81 RPM |
| SRP012922_spleen | 0 .00 RPM | 8 .93 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006477 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007983 | 1 retrocopy |
retro_dnov_104 ,
|
| Erinaceus europaeus | ENSEEUG00000005647 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000002246 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000009228 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000034321 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000011898 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016259 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000003372 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000048708 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000006615 | 1 retrocopy |