RetrogeneDB ID: | retro_dnov_1334 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_1833:173614..173856(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TIPIN | ||
| Ensembl ID: | ENSDNOG00000003177 | ||
| Aliases: | None | ||
| Description: | TIMELESS interacting protein [Source:HGNC Symbol;Acc:30750] |
| Percent Identity: | 86.59 % |
| Parental protein coverage: | 51.27 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | RLISERGLPALRHV-FDKAKFKGRGHEAEDLKTLIRHMEHWAHRLFPKLQFEDFINRVEYLGNKKEVQTC |
| RLISERGLPALR.V..DKAK.KGRGHEA.DLK..IRHMEHWAHRLFPKLQFEDFINRVEYLGN.KEVQTC | |
| Retrocopy | RLISERGLPALRQV<VDKAKSKGRGHEAQDLKMRIRHMEHWAHRLFPKLQFEDFINRVEYLGNEKEVQTC |
| Parental | LKRIRLDLPVLH |
| LKRI.L.LP.LH | |
| Retrocopy | LKRIPLHLPGLH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 2 .92 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 8 .25 RPM |
| SRP012922_heart | 0 .00 RPM | 3 .94 RPM |
| SRP012922_kidney | 0 .00 RPM | 1 .10 RPM |
| SRP012922_liver | 0 .00 RPM | 2 .17 RPM |
| SRP012922_lung | 0 .00 RPM | 5 .96 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 1 .38 RPM |
| SRP012922_spleen | 0 .00 RPM | 7 .33 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004860 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000003177 | 3 retrocopies |
retro_dnov_1334 , retro_dnov_1481, retro_dnov_410,
|
| Homo sapiens | ENSG00000075131 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000000061 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000026016 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000004386 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000003695 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012909 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007192 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000043068 | 1 retrocopy |