RetrogeneDB ID: | retro_dnov_134 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_1977:137188..137530(-) | ||
| Located in intron of: | ENSDNOG00000019818 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LYPLA2 | ||
| Ensembl ID: | ENSDNOG00000011285 | ||
| Aliases: | None | ||
| Description: | lysophospholipase II [Source:HGNC Symbol;Acc:6738] |
| Percent Identity: | 57.26 % |
| Parental protein coverage: | 50.65 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLSHVKYICLHAPRIPVTLNMKM |
| MC.N..S.PL.T...........TA.VIFLH.LGDTGH.W..A...IR.SH.KYICLH.P...V.LNM.M | |
| Retrocopy | MCRNSLSAPLPT---IMPASHKATAVVIFLHRLGDTGHGWVEAFIGIRSSHIKYICLHVPIRSVKLNMNM |
| Parental | VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHERKNGIPANRIV |
| .MPSWFD..GL..D..EDE..IK.A.EN.K.LI..E.KNGIP.NRI. | |
| Retrocopy | SMPSWFDIIGLLHDLKEDEPEIKQAEENVKTLIDQEVKNGIPYNRII |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .58 RPM | 48 .03 RPM |
| SRP012922_cerebellum | 0 .69 RPM | 23 .64 RPM |
| SRP012922_heart | 0 .70 RPM | 9 .75 RPM |
| SRP012922_kidney | 1 .10 RPM | 24 .92 RPM |
| SRP012922_liver | 0 .62 RPM | 10 .37 RPM |
| SRP012922_lung | 0 .76 RPM | 33 .90 RPM |
| SRP012922_quadricep_muscle | 0 .35 RPM | 7 .62 RPM |
| SRP012922_spleen | 0 .92 RPM | 39 .83 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011625 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000020914 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000001461 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000011285 | 2 retrocopies |
retro_dnov_1186, retro_dnov_134 ,
|
| Homo sapiens | ENSG00000011009 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004330 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000004768 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000005841 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008646 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000032260 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001733 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000016127 | 1 retrocopy |