RetrogeneDB ID: | retro_dnov_1519 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_2251:85104..85450(-) | ||
| Located in intron of: | ENSDNOG00000001398 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AAED1 | ||
| Ensembl ID: | ENSDNOG00000024562 | ||
| Aliases: | None | ||
| Description: | AhpC/TSA antioxidant enzyme domain containing 1 [Source:HGNC Symbol;Acc:16881] |
| Percent Identity: | 70.09 % |
| Parental protein coverage: | 61.41 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | TGYSYEIYVDPEREIYKRLGMKRGEEIAASGQSPHVKSNILSGSIRSLWRAVTGPLFDFQGDPAQQGGTL |
| TGYSYEIYVDPEREI.KRLGMKRGEEIAASGQSP.VKSNILSG....LW..VTGP..DFQGDP...GGT. | |
| Retrocopy | TGYSYEIYVDPEREICKRLGMKRGEEIAASGQSPCVKSNILSGCVQILWWVVTGPFYDFQGDPG*EGGTV |
| Parental | ILGP--NIHFIHHDRNRLDH-NPNNSVLQHVGV-HVSFTSRLSVVHL |
| ILGP..NI.FIH.D...LDH..P...V.Q.VGV.HV.FT...SV.H. | |
| Retrocopy | ILGPGSNIYFIHRDKI*LDH>SP-STVIQLVGVQHVNFTRSPSVMHM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .58 RPM | 8 .36 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 5 .09 RPM |
| SRP012922_heart | 0 .93 RPM | 6 .03 RPM |
| SRP012922_kidney | 0 .27 RPM | 7 .12 RPM |
| SRP012922_liver | 0 .00 RPM | 7 .12 RPM |
| SRP012922_lung | 0 .31 RPM | 12 .52 RPM |
| SRP012922_quadricep_muscle | 1 .04 RPM | 6 .58 RPM |
| SRP012922_spleen | 0 .57 RPM | 13 .85 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006422 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007723 | 7 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005509 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000024562 | 4 retrocopies | |
| Homo sapiens | ENSG00000158122 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000008295 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000017058 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000003177 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019418 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021156 | 1 retrocopy |