RetrogeneDB ID: | retro_mmul_2586 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | X:63992308..63992736(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.4817 | ||
| Ensembl ID: | ENSMMUG00000008295 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.69 % |
| Parental protein coverage: | 63.27 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | SGGTAPVPAPSGPDRGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYICKEYVEDLAKI |
| SGG.APV.A.SGP..GQ.L.AA.AELPVLD..GQ.VPFGAL.RERR..V.FV.HFL.YICKEYVE.L.KI | |
| Retrocopy | SGGVAPVQALSGPEHGQSLVAAIAELPVLDSHGQWVPFGALLRERRTMVLFVQHFLFYICKEYVEAL*KI |
| Parental | PKSFLQEANVTLIVIGQSSYHHIEPFCRLTGYSHEIY-VDPEREIYKRLGMKRGEEIASSGQSPHVKSNL |
| .KSFLQEANV.LIVI.QSSYH.IEPFC.L.GYSHEIY...PEREIYKRLGMKRGEE.ASSGQSPHV.S.. | |
| Retrocopy | LKSFLQEANVILIVIEQSSYHPIEPFCKLPGYSHEIY<FHPEREIYKRLGMKRGEEMASSGQSPHVNSQE |
| Parental | LSGS |
| ..G. | |
| Retrocopy | AFGA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 2 .35 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .38 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 3 .42 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .12 RPM |
| SRP007412_kidney | 0 .00 RPM | 7 .39 RPM |
| SRP007412_liver | 0 .00 RPM | 4 .51 RPM |
| SRP007412_testis | 0 .00 RPM | 6 .07 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006422 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007723 | 7 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005509 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000024562 | 4 retrocopies | |
| Homo sapiens | ENSG00000158122 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000008295 | 1 retrocopy |
retro_mmul_2586 ,
|
| Otolemur garnettii | ENSOGAG00000017058 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000003177 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019418 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021156 | 1 retrocopy |