RetrogeneDB ID: | retro_dnov_1609 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_246871:546..874(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C12orf49 | ||
Ensembl ID: | ENSDNOG00000001294 | ||
Aliases: | None | ||
Description: | chromosome 12 open reading frame 49 [Source:HGNC Symbol;Acc:26128] |
Percent Identity: | 70. % |
Parental protein coverage: | 64.88 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | VCERKDLLVNGCCHVHVPSTKQYCCDGCLSNGCCSAYEYCVSCCLQPNKQLLLERFL-NRAAMAFQNLFM |
.CER.D.LVN.CC.VHV.STKQY.CDGCLSN.CCS.YEYCVS.C.Q..KQLLLE.FL.N.AA.A.QN..M | |
Retrocopy | ICERED*LVNDCCPVHVLSTKQYSCDGCLSNDCCSTYEYCVS*CFQFKKQLLLECFL>NQAALAIQNVYM |
Parental | AVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPP |
A.EDHFELCL.KCR.S..S....NTYRDPI.KYCY.E..P | |
Retrocopy | AMEDHFELCLVKCRASPWSMKLQNTYRDPITKYCYSETLP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 2 .14 RPM |
SRP012922_cerebellum | 0 .00 RPM | 3 .85 RPM |
SRP012922_heart | 0 .00 RPM | 0 .00 RPM |
SRP012922_kidney | 0 .00 RPM | 4 .11 RPM |
SRP012922_liver | 0 .00 RPM | 2 .01 RPM |
SRP012922_lung | 0 .00 RPM | 2 .60 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 0 .87 RPM |
SRP012922_spleen | 0 .00 RPM | 2 .63 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000012481 | 2 retrocopies | |
Bos taurus | ENSBTAG00000047139 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009570 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000001294 | 9 retrocopies |
retro_dnov_126, retro_dnov_1532, retro_dnov_1609 , retro_dnov_1622, retro_dnov_1739, retro_dnov_2042, retro_dnov_2185, retro_dnov_2285, retro_dnov_232,
|
Echinops telfairi | ENSETEG00000016892 | 3 retrocopies | |
Homo sapiens | ENSG00000111412 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000015690 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000011912 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000018247 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000005500 | 1 retrocopy |