RetrogeneDB ID: | retro_ptro_2798 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 8:142666107..142666418(-) | ||
Located in intron of: | ENSPTRG00000020669 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C12orf49 | ||
Ensembl ID: | ENSPTRG00000005500 | ||
Aliases: | None | ||
Description: | chromosome 12 open reading frame 49 [Source:HGNC Symbol;Acc:26128] |
Percent Identity: | 66.04 % |
Parental protein coverage: | 51.22 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | WVLALVFGLSLVYFLSSTFKQEER-AVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLI |
W.........L...LSSTF.QEER..VR.R.LLQV.DH.QP.P.KVQ.NLG.SSRP.NQC.NS.QGK.LI | |
Retrocopy | WARGALAQAILIHVLSSTFRQEER<GVRHRTLLQVQDHDQPSPCKVQVNLGSSSRPWNQCQNSVQGKLLI |
Parental | TDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWP |
.DE.GYVCER.DLLV.G.CNV..PS.KQ.CCDGCWP | |
Retrocopy | VDEPGYVCERRDLLVQG-CNVHSPSVKQCCCDGCWP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .09 RPM | 41 .49 RPM |
SRP007412_cerebellum | 0 .11 RPM | 30 .79 RPM |
SRP007412_heart | 0 .00 RPM | 7 .02 RPM |
SRP007412_kidney | 0 .03 RPM | 35 .62 RPM |
SRP007412_liver | 0 .00 RPM | 15 .29 RPM |
SRP007412_testis | 0 .11 RPM | 19 .39 RPM |
Species | RetrogeneDB ID |
---|---|
Macaca mulatta | retro_mmul_2376 |
Callithrix jacchus | retro_cjac_1471 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000012481 | 2 retrocopies | |
Bos taurus | ENSBTAG00000047139 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009570 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000001294 | 9 retrocopies | |
Echinops telfairi | ENSETEG00000016892 | 3 retrocopies | |
Homo sapiens | ENSG00000111412 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000015690 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000011912 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000018247 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000005500 | 1 retrocopy |
retro_ptro_2798 ,
|