RetrogeneDB ID: | retro_ptro_2798 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 8:142666107..142666418(-) | ||
| Located in intron of: | ENSPTRG00000020669 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C12orf49 | ||
| Ensembl ID: | ENSPTRG00000005500 | ||
| Aliases: | None | ||
| Description: | chromosome 12 open reading frame 49 [Source:HGNC Symbol;Acc:26128] |
| Percent Identity: | 66.04 % |
| Parental protein coverage: | 51.22 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | WVLALVFGLSLVYFLSSTFKQEER-AVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLI |
| W.........L...LSSTF.QEER..VR.R.LLQV.DH.QP.P.KVQ.NLG.SSRP.NQC.NS.QGK.LI | |
| Retrocopy | WARGALAQAILIHVLSSTFRQEER<GVRHRTLLQVQDHDQPSPCKVQVNLGSSSRPWNQCQNSVQGKLLI |
| Parental | TDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWP |
| .DE.GYVCER.DLLV.G.CNV..PS.KQ.CCDGCWP | |
| Retrocopy | VDEPGYVCERRDLLVQG-CNVHSPSVKQCCCDGCWP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .09 RPM | 41 .49 RPM |
| SRP007412_cerebellum | 0 .11 RPM | 30 .79 RPM |
| SRP007412_heart | 0 .00 RPM | 7 .02 RPM |
| SRP007412_kidney | 0 .03 RPM | 35 .62 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .29 RPM |
| SRP007412_testis | 0 .11 RPM | 19 .39 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Macaca mulatta | retro_mmul_2376 |
| Callithrix jacchus | retro_cjac_1471 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012481 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000047139 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009570 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000001294 | 9 retrocopies | |
| Echinops telfairi | ENSETEG00000016892 | 3 retrocopies | |
| Homo sapiens | ENSG00000111412 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015690 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011912 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018247 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000005500 | 1 retrocopy |
retro_ptro_2798 ,
|