RetrogeneDB ID: | retro_dnov_803 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_109032:352..682(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM230 | ||
| Ensembl ID: | ENSDNOG00000005724 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 230 [Source:HGNC Symbol;Acc:15876] |
| Percent Identity: | 51.75 % |
| Parental protein coverage: | 80.43 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | LATGIPSSKVKYSRLSSTDDGYID-LQFKKSPPKIPYKAIALATVLFLI-GAFLIIIGSLLLAGYISKGG |
| L...I.S..VKYSRL..TD.G..D.L.F.KS.P..P.KAIA...VLFL..G.FL....SL.L.GY.S..G | |
| Retrocopy | LTPEISSRRVKYSRLPRTDGGSMD<LPFEKSAPESPSKAIAFIAVLFLT<GSFLVVTDSLPLGGYVSNRG |
| Parental | ADRAVPVLIIGILVFLPGFYHLRIAYYASQGY-RGYSYDDIPDF |
| ..R..P.L..GI..FL..FYH.R..Y.AS.G...GYS.DDI..F | |
| Retrocopy | QARPCPLLTTGIPTFLLDFYHVRTVYSASTGV<PGYSSDDILHF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 20 .03 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 12 .23 RPM |
| SRP012922_heart | 0 .00 RPM | 3 .94 RPM |
| SRP012922_kidney | 0 .00 RPM | 19 .44 RPM |
| SRP012922_liver | 0 .00 RPM | 9 .91 RPM |
| SRP012922_lung | 0 .00 RPM | 22 .60 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 5 .19 RPM |
| SRP012922_spleen | 0 .00 RPM | 22 .78 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009083 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000006063 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000006039 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000005724 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000023089 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000008611 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000002863 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000019378 | 1 retrocopy |