RetrogeneDB ID: | retro_ecab_1007 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 9:36381708..36381945(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PDCD5 | ||
| Ensembl ID: | ENSECAG00000019406 | ||
| Aliases: | None | ||
| Description: | programmed cell death 5 [Source:HGNC Symbol;Acc:8764] |
| Percent Identity: | 74.68 % |
| Parental protein coverage: | 76.7 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | VLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSGKVSEQGLIEILEKVSQQTEKKTTVKFNRRKV |
| ....S.R..LSNL.LVK.EKTK.VENYL.QMARY.QLSGKVSEQGLIEIL.K.SQQTE.K.T.KFN.RK. | |
| Retrocopy | IVSIS*RFILSNLVLVKSEKTK*VENYLTQMARYKQLSGKVSEQGLIEILKKISQQTENKATAKFN*RKI |
| Parental | MDSDEDDDY |
| MDSDEDD.Y | |
| Retrocopy | MDSDEDDNY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 3 .13 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 4 .41 RPM |
| SRP021940_embryo | 0 .00 RPM | 7 .34 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 4 .71 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 4 .34 RPM |
| SRP021940_testis | 0 .00 RPM | 15 .79 RPM |