RetrogeneDB ID: | retro_ecab_131 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 1:68498390..68498594(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSECAG00000015464 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.89 % |
| Parental protein coverage: | 65.09 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | MVNVPKTRRT-FCKKCGKHQPHKVTQYKKGK-DSLYAQGKRRYDRKQSGYGGQTKPIFRKKAK-TTKKIV |
| MVN.PKT..T.F..K.GKH.P...T..KK.K..SL.AQGK..YDRKQSG..GQTK.IF.KKAK.T.KKI. | |
| Retrocopy | MVNGPKTWWT<FYNKYGKHHPYQMTECKKNK<ASLNAQGKQHYDRKQSGDDGQTKLIFQKKAK<TAKKIG |
| Parental | LR |
| LR | |
| Retrocopy | LR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 192 .20 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 63 .05 RPM |
| SRP021940_embryo | 0 .08 RPM | 187 .12 RPM |
| SRP021940_placental_villous | 0 .14 RPM | 121 .14 RPM |
| SRP021940_synovial_membrane | 0 .08 RPM | 138 .85 RPM |
| SRP021940_testis | 0 .00 RPM | 58 .12 RPM |