RetrogeneDB ID: | retro_ecab_489 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 2:51392161..51392380(+) | ||
| Located in intron of: | ENSECAG00000009540 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PCBD2 | ||
| Ensembl ID: | ENSECAG00000015810 | ||
| Aliases: | None | ||
| Description: | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 [Source:HGNC Symbol;Acc:24474] |
| Percent Identity: | 71.23 % |
| Parental protein coverage: | 71.57 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | RDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAKFIEKAA |
| RDA.Y.EFSFKNFNQAFGF.S.V..QAEK..HHPE.FN...KVQIT.T.H..GG.TKR.VKL.KF.EKAA | |
| Retrocopy | RDAMYREFSFKNFNQAFGFISQVTIQAEKIKHHPE*FNGHYKVQITFTLHVWGGVTKRNVKLVKFFEKAA |
| Parental | ASV |
| .SV | |
| Retrocopy | VSV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 1 .30 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 2 .34 RPM |
| SRP021940_embryo | 0 .10 RPM | 3 .73 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 2 .84 RPM |
| SRP021940_synovial_membrane | 0 .05 RPM | 3 .24 RPM |
| SRP021940_testis | 0 .00 RPM | 4 .73 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000019125 | 2 retrocopies | |
| Equus caballus | ENSECAG00000015810 | 2 retrocopies |
retro_ecab_489 , retro_ecab_871,
|
| Erinaceus europaeus | ENSEEUG00000007051 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000016658 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000003784 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012638 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000014351 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000000384 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000016874 | 3 retrocopies |